Misplaced Pages

Altitoxin

Article snapshot taken from Wikipedia with creative commons attribution-sharealike license. Give it a read and then ask your questions in the chat. We can research this topic together.
Neurotoxin
This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.
Find sources: "Altitoxin" – news · newspapers · books · scholar · JSTOR (March 2018)

Altitoxin is a neurotoxin found in the South African scorpion Parabuthus transvaalicus. Injection of altitoxin in mice leads to akinesia, depression and death.

Sources

South African spitting scorpion (Parabuthus transvaalicus)

Altitoxin is secreted by the venom gland of the South African spitting (or fattail) scorpion Parabuthus transvaalicus.

Chemistry

Altitoxin, with the amino acid sequence ADVPGNYPLDKDGNTYTCLELGENKDCQKVCKLHGVQYGYCYAFFCWCKELDDKDVSV, is 58 amino acid residues long and has a molecular mass of 6598 Da; it has 3 disulfide bridges (Cys18-Cys41, Cys27-Cys46, and Cys31-Cys48). It has large homology to other toxins from the venom of Parabuthus transvaalicus, including bestoxin, birtoxin, ikitoxin and dortoxin.

Target

Altitoxin has sequence homology to scorpion β-toxins, suggesting it might target sodium channels. However, its depressing action following injection into mice is not in agreement with the effect of β-toxins on sodium channels. Related scorpion toxins, which include birtoxin and bestoxin, exhibit highly divergent biological activity, indicating that the mode of action of these toxins is highly diverse.

Toxicity

An injection of 100 ng altitoxin in 20 g mouse (ED99) causes a state of akinesia and depression. Lethality is reached at injecting 200 ng.

References

  1. ^ Inceoglu, B.; Lango, J.; Pessah, I. N.; Hammock, B. D. (2005). "Three structurally related, highly potent, peptides from the venom of Parabuthus transvaalicus possess divergent biological activity". Toxicon. 45 (6): 727–33. Bibcode:2005Txcn...45..727I. doi:10.1016/j.toxicon.2005.01.020. PMID 15804521.
Categories: